Lineage for d1k8fa_ (1k8f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813733Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) (S)
    superhelix turns are made of two strands each
    automatically mapped to Pfam PF08603
  5. 2813734Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (2 proteins)
    this is a repeat family; one repeat unit is 1k4z A:1424-1443 found in domain
  6. 2813735Protein C-terminal domain of adenylylcyclase associated protein [69342] (2 species)
  7. 2813741Species Human (Homo sapiens) [TaxId:9606] [89399] (1 PDB entry)
  8. 2813742Domain d1k8fa_: 1k8f A: [84344]

Details for d1k8fa_

PDB Entry: 1k8f (more details), 2.8 Å

PDB Description: crystal structure of the human c-terminal cap1-adenylyl cyclase associated protein
PDB Compounds: (A:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1k8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8fa_ b.80.5.1 (A:) C-terminal domain of adenylylcyclase associated protein {Human (Homo sapiens) [TaxId: 9606]}
pavlelegkkwrvenqenvsnlviedtelkqvayiykcvnttlqikgkinsitvdnckkl
glvfddvvgiveiinskdvkvqvmgkvptisinktdgchaylsknsldceivsakssemn
vlipteggdfnefpvpeqfktlwngqklvttvteiag

SCOPe Domain Coordinates for d1k8fa_:

Click to download the PDB-style file with coordinates for d1k8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1k8fa_: