Class b: All beta proteins [48724] (180 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) superhelix turns are made of two strands each automatically mapped to Pfam PF08603 |
Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (2 proteins) this is a repeat family; one repeat unit is 1k4z A:1424-1443 found in domain |
Protein C-terminal domain of adenylylcyclase associated protein [69342] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89399] (1 PDB entry) |
Domain d1k8fa_: 1k8f A: [84344] |
PDB Entry: 1k8f (more details), 2.8 Å
SCOPe Domain Sequences for d1k8fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8fa_ b.80.5.1 (A:) C-terminal domain of adenylylcyclase associated protein {Human (Homo sapiens) [TaxId: 9606]} pavlelegkkwrvenqenvsnlviedtelkqvayiykcvnttlqikgkinsitvdnckkl glvfddvvgiveiinskdvkvqvmgkvptisinktdgchaylsknsldceivsakssemn vlipteggdfnefpvpeqfktlwngqklvttvteiag
Timeline for d1k8fa_: