Lineage for d1k5na2 (1k5n A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937880Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
    Uniprot P03989 25-300
  8. 2937881Domain d1k5na2: 1k5n A:1-181 [77267]
    Other proteins in same PDB: d1k5na1, d1k5nb1, d1k5nb2
    complexed with gol

Details for d1k5na2

PDB Entry: 1k5n (more details), 1.09 Å

PDB Description: hla-b*2709 bound to nona-peptide m9
PDB Compounds: (A:) major histocompatibility complex molecule HLA-B*2709

SCOPe Domain Sequences for d1k5na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5na2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqhaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d1k5na2:

Click to download the PDB-style file with coordinates for d1k5na2.
(The format of our PDB-style files is described here.)

Timeline for d1k5na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k5na1