Lineage for d1k5ba_ (1k5b A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Angiogenin [54094] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries)
  8. Domain d1k5ba_: 1k5b A: [72075]
    complexed with cit

Details for d1k5ba_

PDB Entry: 1k5b (more details), 1.8 Å

PDB Description: crystal structure of human angiogenin variant des(121-123)
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d1k5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5ba_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif

SCOPe Domain Coordinates for d1k5ba_ are not available.

Timeline for d1k5ba_: