Lineage for d1k2da1 (1k2d A:82-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747416Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747422Domain d1k2da1: 1k2d A:82-181 [84291]
    Other proteins in same PDB: d1k2da2, d1k2da3, d1k2db1, d1k2db2
    complexed with nag

Details for d1k2da1

PDB Entry: 1k2d (more details), 2.2 Å

PDB Description: crystal structure of the autoimmune mhc class ii i-au complexed with myelin basic protein 1-11 at 2.2a
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d1k2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2da1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d1k2da1:

Click to download the PDB-style file with coordinates for d1k2da1.
(The format of our PDB-style files is described here.)

Timeline for d1k2da1: