Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.6: N-acetylmuramoyl-L-alanine amidase-like [102517] (2 proteins) automatically mapped to Pfam PF01520 |
Protein N-acetylmuramoyl-L-alanine amidase CwlV [102518] (1 species) |
Species Paenibacillus polymyxa [TaxId:1406] [102519] (1 PDB entry) |
Domain d1jwqa_: 1jwq A: [90921] complexed with zn |
PDB Entry: 1jwq (more details), 1.8 Å
SCOPe Domain Sequences for d1jwqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwqa_ c.56.5.6 (A:) N-acetylmuramoyl-L-alanine amidase CwlV {Paenibacillus polymyxa [TaxId: 1406]} mkvvvidaghgakdsgavgisrknyektfnlamalkvesilkqnpklevvltrsddtfle lkqrvkvaenlkanvfvsihanssgssasngtetyyqrsaskafanvmhkyfapatgltd rgirygnfhvirettmpavllevgylsnakeeatlfdedfqnrvaqgiadgiteyldvk
Timeline for d1jwqa_: