Lineage for d1jw1a2 (1jw1 A:334-689)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.2: Transferrin [53888] (4 proteins)
further duplication: composed of two two-domain lobes
Protein Lactoferrin [53889] (6 species) 
Species Goat (Capra hircus) [TaxId:9925] [89791] (1 PDB entry) 
Domain d1jw1a2: 1jw1 A:334-689 [84235]
complexed with fe
Details for d1jw1a2
PDB Entry: 1jw1 (more details), 4 Å
PDB Description: Crystallization and structure determination of goat lactoferrin at 4.0 resolution: A new form of packing in lactoferrins with a high solvent content in crystals
PDB Compounds: (A:) lactoferrinSCOPe Domain Sequences for d1jw1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jw1a2 c.94.1.2 (A:334-689) Lactoferrin {Goat (Capra hircus) [TaxId: 9925]}
taeevkarctrvvwcavgpeeqskcqqwseqsgqnvtcatasttddcialvlkgeadals
ldggyiytagkcglvpvmaenrksskhssldcvlrptegylavavvkkanegltwnslkg
kkschtavdrtagwnipmglianqtgscafdeffsqscapgadpksslcalcagddqgld
kcvpnskekyygytgafrclaedvgdvafvkndtvwentngessadwaknlnredfrllc
ldgttkpvteaqscylavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfk
setknllfndnteclaklggrptyekylgteyvtaianlkkcstsplleacafltr
SCOPe Domain Coordinates for d1jw1a2:
Click to download the PDB-style file with coordinates for d1jw1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jw1a2:
- d1jw1a2 first appeared in SCOP 1.65
- d1jw1a2 appears in SCOPe 2.07
View in 3D
