![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
![]() | Protein Sorcin [69023] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69024] (4 PDB entries) |
![]() | Domain d1juoa_: 1juo A: [67312] |
PDB Entry: 1juo (more details), 2.2 Å
SCOPe Domain Sequences for d1juoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
Timeline for d1juoa_: