Lineage for d1jtda_ (1jtd A:)
- Root: SCOPe 2.03
Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) 
Protein beta-Lactamase, class A [56606] (16 species) Species Escherichia coli, TEM-1 [TaxId:562] [56607] (36 PDB entries) 
Domain d1jtda_: 1jtd A: [67264]
Other proteins in same PDB: d1jtdb_
complexed with ca
Details for d1jtda_
PDB Entry: 1jtd (more details), 2.3 Å
PDB Description: Crystal structure of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase
PDB Compounds: (A:) tem-1 beta-lactamaseSCOPe Domain Sequences for d1jtda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtda_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
petlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvda
gqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpk
eltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqq
lidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgs
qatmdernrqiaeigaslikhw
SCOPe Domain Coordinates for d1jtda_:
Click to download the PDB-style file with coordinates for d1jtda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jtda_:
- d1jtda_ first appeared in SCOP 1.59
- d1jtda_ appears in SCOPe 2.02
- d1jtda_ appears in SCOPe 2.04
- d1jtda_ appears in the current release, SCOPe 2.08
View in 3D
