Lineage for d1jssa_ (1jss A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.2: STAR domain [55966] (5 proteins)
automatically mapped to Pfam PF01852
Protein Cholesterol-regulated Start protein 4 (Stard4). [75545] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [75546] (1 PDB entry) 
Domain d1jssa_: 1jss A: [71844]
Details for d1jssa_
PDB Entry: 1jss (more details), 2.2 Å
PDB Description: crystal structure of the mus musculus cholesterol-regulated start protein 4 (stard4).
PDB Compounds: (A:) cholesterol-regulated START protein 4SCOPe Domain Sequences for d1jssa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]}
asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi
dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee
gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd
tamastlanfysdlrkglr
SCOPe Domain Coordinates for d1jssa_:
Click to download the PDB-style file with coordinates for d1jssa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jssa_:
- d1jssa_ first appeared in SCOP 1.61
- d1jssa_ appears in SCOPe 2.05
- d1jssa_ appears in SCOPe 2.07
- d1jssa_ appears in the current release, SCOPe 2.08
View in 3D
