Lineage for d1jspb_ (1jsp B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767486Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 767487Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 767488Protein CREB-binding protein, CBP [74712] (1 species)
  7. 767489Species Human (Homo sapiens) [TaxId:9606] [74713] (4 PDB entries)
  8. 767494Domain d1jspb_: 1jsp B: [71843]
    complexed with p53 peptide, chain A
    complexed with aly

Details for d1jspb_

PDB Entry: 1jsp (more details)

PDB Description: nmr structure of cbp bromodomain in complex with p53 peptide
PDB Compounds: (B:) creb-binding protein

SCOP Domain Sequences for d1jspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jspb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

SCOP Domain Coordinates for d1jspb_:

Click to download the PDB-style file with coordinates for d1jspb_.
(The format of our PDB-style files is described here.)

Timeline for d1jspb_: