Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
Protein Terminal deoxynucleotidyl transferase [81583] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81582] (3 PDB entries) |
Domain d1jmsa3: 1jms A:243-302 [75862] Other proteins in same PDB: d1jmsa1, d1jmsa4 complexed with mg, na |
PDB Entry: 1jms (more details), 2.36 Å
SCOPe Domain Sequences for d1jmsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d1jmsa3: