Lineage for d1jmab2 (1jma B:60-105)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.24: TNF receptor-like [57585] (1 superfamily)
duplication: consists of three similar disulfide-rich domainsSuperfamily g.24.1: TNF receptor-like [57586] (3 families) 
Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
Pfam PF00020; TNFR/NGFR cysteine-rich region- Protein Cellular receptor HveA, C-terminal domain [419059] (1 species)
- Species Human (Homo sapiens) [TaxId:9606] [419550] (2 PDB entries)
Domain d1jmab2: 1jma B:60-105 [63179]
Other proteins in same PDB: d1jmaa_, d1jmab1
complexed with so4
Details for d1jmab2
PDB Entry: 1jma (more details), 2.65 Å
PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem
PDB Compounds: (B:) herpesvirus entry mediatorSCOPe Domain Sequences for d1jmab2:
Sequence, based on SEQRES records: (download)
>d1jmab2 g.24.1.1 (B:60-105) Cellular receptor HveA, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayat
Sequence, based on observed residues (ATOM records): (download)
>d1jmab2 g.24.1.1 (B:60-105) Cellular receptor HveA, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdhcaacrayat
SCOPe Domain Coordinates for d1jmab2:
Click to download the PDB-style file with coordinates for d1jmab2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jmab2:
- d1jmab2 first appeared in SCOP 1.57
- d1jmab2 appears in SCOPe 2.07
View in 3D
