Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein RNase H (RNase HI) [53100] (4 species) |
Species synthetic, Escherichia coli/Thermus thermophilus chimera [69532] (1 PDB entry) |
Domain d1jl2c_: 1jl2 C: [66824] |
PDB Entry: 1jl2 (more details), 1.76 Å
SCOPe Domain Sequences for d1jl2c_:
Sequence, based on SEQRES records: (download)
>d1jl2c_ c.55.3.1 (C:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera} kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv kghaghpeneradelaraaamnptledtgyq
>d1jl2c_ c.55.3.1 (C:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera} kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep aevdlytdshylkkaftevknrdlwealllamaphrvrfhfvkghaghpeneradelara aamnptledtgyq
Timeline for d1jl2c_: