Lineage for d1jkjb2 (1jkj B:1-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978768Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2978769Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2978770Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 2978775Domain d1jkjb2: 1jkj B:1-238 [66803]
    Other proteins in same PDB: d1jkja1, d1jkja2, d1jkjb1, d1jkjd1, d1jkjd2, d1jkje1
    complexed with coa, gol, po4, so4

Details for d1jkjb2

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS
PDB Compounds: (B:) succinyl-CoA synthetase beta subunit

SCOPe Domain Sequences for d1jkjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkjb2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d1jkjb2:

Click to download the PDB-style file with coordinates for d1jkjb2.
(The format of our PDB-style files is described here.)

Timeline for d1jkjb2: