Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Peptide transporter Tap1, C-terminal ABC domain [64029] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64030] (1 PDB entry) |
Domain d1jj7a_: 1jj7 A: [63114] complexed with adp, mg |
PDB Entry: 1jj7 (more details), 2.4 Å
SCOPe Domain Sequences for d1jj7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} glltplhleglvqfqdvsfaypnrpdvlvlqgltftlrpgevtalvgpngsgkstvaall qnlyqptggqllldgkplpqyehrylhrqvaavgqepqvfgrslqeniaygltqkptmee itaaavksgahsfisglpqgydtevdeagsqlsggqrqavalaralirkpcvlilddats aldansqlqveqllyesperysrsvllitqhlslveqadhilfleggaireggthqqlme kkgcywamvqa
Timeline for d1jj7a_: