Lineage for d1jj7a_ (1jj7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127048Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2127255Protein Peptide transporter Tap1, C-terminal ABC domain [64029] (1 species)
  7. 2127256Species Human (Homo sapiens) [TaxId:9606] [64030] (1 PDB entry)
  8. 2127257Domain d1jj7a_: 1jj7 A: [63114]
    complexed with adp, mg

Details for d1jj7a_

PDB Entry: 1jj7 (more details), 2.4 Å

PDB Description: crystal structure of the c-terminal atpase domain of human tap1
PDB Compounds: (A:) peptide transporter tap1

SCOPe Domain Sequences for d1jj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}
glltplhleglvqfqdvsfaypnrpdvlvlqgltftlrpgevtalvgpngsgkstvaall
qnlyqptggqllldgkplpqyehrylhrqvaavgqepqvfgrslqeniaygltqkptmee
itaaavksgahsfisglpqgydtevdeagsqlsggqrqavalaralirkpcvlilddats
aldansqlqveqllyesperysrsvllitqhlslveqadhilfleggaireggthqqlme
kkgcywamvqa

SCOPe Domain Coordinates for d1jj7a_:

Click to download the PDB-style file with coordinates for d1jj7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jj7a_: