Lineage for d1jj2b_ (1jj2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793163Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2793164Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2793205Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 2793211Domain d1jj2b_: 1jj2 B: [63086]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2b_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
PDB Compounds: (B:) ribosomal protein l3

SCOPe Domain Sequences for d1jj2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2b_ b.43.3.2 (B:) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1jj2b_:

Click to download the PDB-style file with coordinates for d1jj2b_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2b_: