Lineage for d1jiea_ (1jie A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
duplication: consists of two clear structural repeats each having this fold
subunit fold and dimeric assembly are similar to those of glyoxalase
Protein Bleomycin resistance protein, BRP [54599] (3 species)
Active as dimer
Species Streptomyces verticillus [TaxId:29309] [54600] (3 PDB entries) 
Domain d1jiea_: 1jie A: [66736]
complexed with blm
Details for d1jiea_
PDB Entry: 1jie (more details), 1.8 Å
PDB Description: crystal structure of bleomycin-binding protein from bleomycin- producing streptomyces verticillus complexed with metal-free bleomycin
PDB Compounds: (A:) bleomycin-binding proteinSCOPe Domain Sequences for d1jiea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiea_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]}
mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
ge
SCOPe Domain Coordinates for d1jiea_:
Click to download the PDB-style file with coordinates for d1jiea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jiea_:
- d1jiea_ first appeared in SCOP 1.59
- d1jiea_ appears in SCOPe 2.04
- d1jiea_ appears in SCOPe 2.06
- d1jiea_ appears in the current release, SCOPe 2.08
View in 3D
