Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.2: LexA repressor, N-terminal DNA-binding domain [46789] (1 protein) automatically mapped to Pfam PF01726 |
Protein LexA repressor, N-terminal DNA-binding domain [46790] (1 species) |
Species Escherichia coli [TaxId:562] [46791] (4 PDB entries) |
Domain d1jhfa1: 1jhf A:2-72 [63057] Other proteins in same PDB: d1jhfa2, d1jhfb_ complexed with so4; mutant |
PDB Entry: 1jhf (more details), 1.8 Å
SCOPe Domain Sequences for d1jhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg asrgirllqee
Timeline for d1jhfa1: