Lineage for d1jhda2 (1jhd A:174-396)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
automatically mapped to Pfam PF01747
Protein ATP sulfurylase catalytic domain [63980] (5 species) Species Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId:35843] [69455] (1 PDB entry)
lacks the C-terminal domain
Domain d1jhda2: 1jhd A:174-396 [66713]
Other proteins in same PDB: d1jhda1
complexed with br, so4
Details for d1jhda2
PDB Entry: 1jhd (more details), 1.7 Å
PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont
PDB Compounds: (A:) sulfate adenylyltransferaseSCOPe Domain Sequences for d1jhda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]}
pdtfrtaveirneikehgwskvvafqtrnpmhraheelcrmamesldadgvvvhmllgkl
kkgdipapvrdaairtmaevyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfi
igrdhagvgdyygafdaqtifddevpegameieifradhtayskklnkivmmrdvpdhtk
edfvllsgtkvremlgqgiapppefsrpevakilmdyyqsins
SCOPe Domain Coordinates for d1jhda2:
Click to download the PDB-style file with coordinates for d1jhda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jhda2:
- d1jhda2 first appeared in SCOP 1.59
- d1jhda2 appears in SCOPe 2.05
- d1jhda2 appears in SCOPe 2.07
- d1jhda2 appears in the current release, SCOPe 2.08
View in 3D
