Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Multiple antibiotic resistance repressor, MarR [68970] (1 species) |
Species Escherichia coli [TaxId:562] [68971] (1 PDB entry) |
Domain d1jgsa_: 1jgs A: [66683] complexed with sal |
PDB Entry: 1jgs (more details), 2.3 Å
SCOPe Domain Sequences for d1jgsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} lfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsv dlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltkn ltadevatleyllkkvlp
Timeline for d1jgsa_: