Lineage for d1jg1a_ (1jg1 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1175876Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
    topological variant; strand order 3214567; strand 6 is antiparallel to the rest
  6. 1175877Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)
  7. 1175883Species Pyrococcus furiosus [TaxId:2261] [69553] (4 PDB entries)
  8. 1175884Domain d1jg1a_: 1jg1 A: [66661]
    complexed with sah

Details for d1jg1a_

PDB Entry: 1jg1 (more details), 1.2 Å

PDB Description: crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosyl-l-homocysteine
PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d1jg1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Pyrococcus furiosus [TaxId: 2261]}
ekelyekwmrtvemlkaegiirskeveraflkyprylsvedkykkyahideplpipagqt
vsaphmvaimleianlkpgmnilevgtgsgwnaaliseivktdvytieripelvefakrn
leragvknvhvilgdgskgfppkapydviivtagapkipeplieqlkiggkliipvgsyh
lwqellevrktkdgikiknhggvafvpligeygwk

SCOPe Domain Coordinates for d1jg1a_:

Click to download the PDB-style file with coordinates for d1jg1a_.
(The format of our PDB-style files is described here.)

Timeline for d1jg1a_: