Lineage for d1jfra_ (1jfr A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.16: Lipase [53555] (2 proteins) 
Protein Lipase [53556] (1 species) Species Streptomyces exfoliatus [TaxId:1905] [53557] (1 PDB entry) 
Domain d1jfra_: 1jfr A: [34724]
Details for d1jfra_
PDB Entry: 1jfr (more details), 1.9 Å
PDB Description: crystal structure of the streptomyces exfoliatus lipase at 1.9a resolution: a model for a family of platelet-activating factor acetylhydrolases
PDB Compounds: (A:) LipaseSCOPe Domain Sequences for d1jfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}
npyergpaptnasieasrgpyatsqtsvsslvasgfgggtiyyptstadgtfgavvispg
ftayqssiawlgprlasqgfvvftidtnttldqpdsrgrqllsaldyltqrssvrtrvda
trlgvmghsmggggsleaaksrtslkaaipltgwntdktwpelrtptlvvgadgdtvapv
athskpfyeslpgsldkaylelrgashftpntsdttiakysiswlkrfidsdtryeqflc
piprpsltiaeyrgtcphts
SCOPe Domain Coordinates for d1jfra_:
Click to download the PDB-style file with coordinates for d1jfra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfra_:
- d1jfra_ first appeared (with stable ids) in SCOP 1.55
- d1jfra_ appears in SCOPe 2.03
- d1jfra_ appears in SCOPe 2.05
- d1jfra_ appears in the current release, SCOPe 2.08
View in 3D
