Lineage for d1jfna_ (1jfn A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963115Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1963116Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1963117Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1963118Protein Apolipoprotein A [57455] (3 species)
  7. 1963123Species Human (Homo sapiens), IV-6 variant [TaxId:9606] [75673] (1 PDB entry)
  8. 1963124Domain d1jfna_: 1jfn A: [71660]

Details for d1jfna_

PDB Entry: 1jfn (more details)

PDB Description: solution structure of human apolipoprotein(a) kringle iv type 6
PDB Compounds: (A:) apolipoprotein a, kiv-t6

SCOPe Domain Sequences for d1jfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfna_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-6 variant [TaxId: 9606]}
arihhhhhhiegrapteqspgvqdcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrt
teyypnggltrnycrnpdaeispwcytmdpnvrweycnltqcpvtessvlatstavseq

SCOPe Domain Coordinates for d1jfna_:

Click to download the PDB-style file with coordinates for d1jfna_.
(The format of our PDB-style files is described here.)

Timeline for d1jfna_: