Lineage for d1jc6a_ (1jc6 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032708Protein Venom basic protease inhibitor IX (VIIIb) [90155] (1 species)
  7. 3032709Species Banded krait (Bungarus fasciatus) [TaxId:8613] [90156] (1 PDB entry)
  8. 3032710Domain d1jc6a_: 1jc6 A: [84152]

Details for d1jc6a_

PDB Entry: 1jc6 (more details)

PDB Description: solution structure of bungarus faciatus ix, a kunitz-type chymotrypsin inhibitor
PDB Compounds: (A:) venom basic protease inhibitors ix and viiib

SCOPe Domain Sequences for d1jc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]}
knrptfcnllpetgrcnalipafyynshlhkcqkfnyggcggnannfktidecqrtcaak
ygrss

SCOPe Domain Coordinates for d1jc6a_:

Click to download the PDB-style file with coordinates for d1jc6a_.
(The format of our PDB-style files is described here.)

Timeline for d1jc6a_: