Lineage for d1jc4a_ (1jc4 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200465Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1200466Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1200766Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
    Different association of repeats but a similar dimeric structure to the glyoxalase dimer
  6. 1200767Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 1200768Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 1200769Domain d1jc4a_: 1jc4 A: [62863]
    complexed with so4

Details for d1jc4a_

PDB Entry: 1jc4 (more details), 2 Å

PDB Description: crystal structure of se-met methylmalonyl-coa epimerase
PDB Compounds: (A:) Methylmalonyl-CoA Epimerase

SCOPe Domain Sequences for d1jc4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]}
nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
ggnrinfmhpksgkgvlieltqypk

SCOPe Domain Coordinates for d1jc4a_:

Click to download the PDB-style file with coordinates for d1jc4a_.
(The format of our PDB-style files is described here.)

Timeline for d1jc4a_: