Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein Lymphotactin [69632] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69633] (2 PDB entries) |
Domain d1j9oa_: 1j9o A: [66460] |
PDB Entry: 1j9o (more details)
SCOPe Domain Sequences for d1j9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9oa_ d.9.1.1 (A:) Lymphotactin {Human (Homo sapiens) [TaxId: 9606]} vgsevsdkrtcvslttqrlpvsriktytitegslravifitkrglkvcadpqatwvrdvv rsmdrksntrnnmiqtkptgtqqstntavtltg
Timeline for d1j9oa_: