Lineage for d1j3na2 (1j3n A:250-408)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164634Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2164682Species Thermus thermophilus [TaxId:274] [89792] (1 PDB entry)
  8. 2164684Domain d1j3na2: 1j3n A:250-408 [84075]
    structural genomics
    complexed with cit, mg

Details for d1j3na2

PDB Entry: 1j3n (more details), 2 Å

PDB Description: Crystal Structure of 3-oxoacyl-(acyl-carrier protein) Synthase II from Thermus thermophilus HB8
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier protein) synthase II

SCOPe Domain Sequences for d1j3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]}
riyaelvgfgrsadahhitephpegkgaalamaralkdagiapeqvgyinahgtstpvgd
raevlaikrvfgdhakrlmvsstksmighllgaagaveaiatvqalyhgvipptinledp
dpeldldfvpepreakvdyalsnsfafgghnavlafkrv

SCOPe Domain Coordinates for d1j3na2:

Click to download the PDB-style file with coordinates for d1j3na2.
(The format of our PDB-style files is described here.)

Timeline for d1j3na2:

2164684
d1j3na2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1j3na1