Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Hypothetical rubrerythrin [101130] (1 species) |
Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry) |
Domain d1j30a_: 1j30 A: [90806] segment-swapped dimer complexed with fe, oxy, zn |
PDB Entry: 1j30 (more details), 1.7 Å
SCOPe Domain Sequences for d1j30a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]} dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl araekshaekfqnvlkqlkgg
Timeline for d1j30a_: