Lineage for d1j30a_ (1j30 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.1: Ferritin [47241] (10 proteins) 
Protein Hypothetical rubrerythrin [101130] (1 species) Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry) 
Domain d1j30a_: 1j30 A: [90806]
segment-swapped dimer
complexed with fe, oxy, zn
Details for d1j30a_
PDB Entry: 1j30 (more details), 1.7 Å
PDB Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon
PDB Compounds: (A:) 144aa long hypothetical rubrerythrinSCOPe Domain Sequences for d1j30a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]}
dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
araekshaekfqnvlkqlkgg
SCOPe Domain Coordinates for d1j30a_:
Click to download the PDB-style file with coordinates for d1j30a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j30a_:
- d1j30a_ first appeared in SCOP 1.67
- d1j30a_ appears in SCOPe 2.04
- d1j30a_ appears in SCOPe 2.06
- d1j30a_ appears in the current release, SCOPe 2.08
View in 3D
