Lineage for d1j2wa_ (1j2w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834502Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2834527Species Thermus thermophilus [TaxId:274] [89492] (2 PDB entries)
  8. 2834532Domain d1j2wa_: 1j2w A: [84043]
    structural genomics

Details for d1j2wa_

PDB Entry: 1j2w (more details), 1.5 Å

PDB Description: Tetrameric Structure of aldolase from Thermus thermophilus HB8
PDB Compounds: (A:) Aldolase protein

SCOPe Domain Sequences for d1j2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2wa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]}
mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
aaggirdretalrmlkagasrlgtssgvalva

SCOPe Domain Coordinates for d1j2wa_:

Click to download the PDB-style file with coordinates for d1j2wa_.
(The format of our PDB-style files is described here.)

Timeline for d1j2wa_: