Lineage for d1iyka1 (1iyk A:60-224)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) 
Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
duplication: consists of two NAT-like domains swapped with the C-terminal strandsProtein N-myristoyl transferase, NMT [55749] (4 species) 
Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries) 
Domain d1iyka1: 1iyk A:60-224 [76958]
complexed with mim, mya
Details for d1iyka1
PDB Entry: 1iyk (more details), 2.3 Å
PDB Description: Crystal structure of candida albicans N-myristoyltransferase with myristoyl-COA and peptidic inhibitor
PDB Compounds: (A:) Myristoyl-CoA:Protein N-MyristoyltransferaseSCOPe Domain Sequences for d1iyka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
egpidklktpedvpndplplisdfewstldiddnlqldelykllydnyvedidatfrfky
sheffqwalkppgwrkdwhvgvrvkstgklvafiaatpvtfklnksnkvidsveinflci
hkklrnkrlapvlikeitrrvnkqniwqalytggsilptplttcr
SCOPe Domain Coordinates for d1iyka1:
Click to download the PDB-style file with coordinates for d1iyka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iyka1:
- d1iyka1 first appeared in SCOP 1.63
- d1iyka1 appears in SCOPe 2.07
View in 3D
