Lineage for d1iyha1 (1iyh A:76-199)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999324Protein Class sigma GST [81351] (5 species)
  7. 1999337Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1999354Domain d1iyha1: 1iyh A:76-199 [83790]
    Other proteins in same PDB: d1iyha2, d1iyhb2, d1iyhc2, d1iyhd2
    complexed with gsh, mg

Details for d1iyha1

PDB Entry: 1iyh (more details), 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1iyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyha1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d1iyha1:

Click to download the PDB-style file with coordinates for d1iyha1.
(The format of our PDB-style files is described here.)

Timeline for d1iyha1: