Lineage for d1iwha_ (1iwh A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin, alpha-chain [46486] (23 species) 
Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries) 
Domain d1iwha_: 1iwh A: [76882]
Other proteins in same PDB: d1iwhb_
complexed with cmo, hem, pem
Details for d1iwha_
PDB Entry: 1iwh (more details), 1.55 Å
PDB Description: Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution: A Novel Allosteric Binding Site in R-State Hemoglobin
PDB Compounds: (A:) hemoglobin alpha chainSCOPe Domain Sequences for d1iwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr
SCOPe Domain Coordinates for d1iwha_:
Click to download the PDB-style file with coordinates for d1iwha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iwha_:
- d1iwha_ first appeared in SCOP 1.63
- d1iwha_ appears in SCOPe 2.04
- d1iwha_ appears in SCOPe 2.06
- d1iwha_ appears in the current release, SCOPe 2.08
View in 3D
