Lineage for d1ivga_ (1ivg A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Influenza neuraminidase [50943] (2 species) Species Influenza A virus, different strains [TaxId:11320] [50944] (62 PDB entries)
Uniprot P03472 84-470
Domain d1ivga_: 1ivg A: [27578]
complexed with ca
Details for d1ivga_
PDB Entry: 1ivg (more details), 1.9 Å
PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
PDB Compounds: (A:) influenza a subtype n2 neuraminidaseSCOPe Domain Sequences for d1ivga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivga_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi
SCOPe Domain Coordinates for d1ivga_:
Click to download the PDB-style file with coordinates for d1ivga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ivga_:
- d1ivga_ first appeared (with stable ids) in SCOP 1.55, called d1ivg__
- d1ivga_ appears in SCOPe 2.02
- d1ivga_ appears in SCOPe 2.04
- d1ivga_ appears in the current release, SCOPe 2.08
View in 3D
