Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltooligosyl trehalose synthase [82177] (1 species) |
Species Sulfolobus acidocaldarius [TaxId:2285] [82178] (1 PDB entry) |
Domain d1iv8a1: 1iv8 A:654-720 [76842] Other proteins in same PDB: d1iv8a2 |
PDB Entry: 1iv8 (more details), 1.9 Å
SCOPe Domain Sequences for d1iv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv8a1 b.71.1.1 (A:654-720) Maltooligosyl trehalose synthase {Sulfolobus acidocaldarius [TaxId: 2285]} eykgldleeglcgfirfnkilviiktkgsvnyklkleegaiytdvltgeeikkevqinel prilvrm
Timeline for d1iv8a1: