Lineage for d1iv8a1 (1iv8 A:654-720)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Maltooligosyl trehalose synthase [82177] (1 species) Species Sulfolobus acidocaldarius [TaxId:2285] [82178] (1 PDB entry) 
Domain d1iv8a1: 1iv8 A:654-720 [76842]
Other proteins in same PDB: d1iv8a2
Details for d1iv8a1
PDB Entry: 1iv8 (more details), 1.9 Å
PDB Description: Crystal Structure of Maltooligosyl trehalose synthase
PDB Compounds: (A:) maltooligosyl trehalose synthaseSCOPe Domain Sequences for d1iv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv8a1 b.71.1.1 (A:654-720) Maltooligosyl trehalose synthase {Sulfolobus acidocaldarius [TaxId: 2285]}
eykgldleeglcgfirfnkilviiktkgsvnyklkleegaiytdvltgeeikkevqinel
prilvrm
SCOPe Domain Coordinates for d1iv8a1:
Click to download the PDB-style file with coordinates for d1iv8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iv8a1:
- d1iv8a1 first appeared in SCOP 1.63
- d1iv8a1 appears in SCOPe 2.05
- d1iv8a1 appears in SCOPe 2.07
- d1iv8a1 appears in the current release, SCOPe 2.08
View in 3D
