Lineage for d1it9l1 (1it9 L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740766Domain d1it9l1: 1it9 L:1-111 [76785]
    Other proteins in same PDB: d1it9h1, d1it9h2, d1it9l2
    part of humanized anti-human Fas Fab HFE7A

Details for d1it9l1

PDB Entry: 1it9 (more details), 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a
PDB Compounds: (L:) humanized antibody hfe7a, light chain

SCOPe Domain Sequences for d1it9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it9l1 b.1.1.1 (L:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
eivltqspgtlslspgeratlsckasqsvdydgdsymnwyqqkpgqaprlliyaasnles
gipdrfsgsgsgtdftltisrlepedfavyycqqsnedprtfgqgtkleik

SCOPe Domain Coordinates for d1it9l1:

Click to download the PDB-style file with coordinates for d1it9l1.
(The format of our PDB-style files is described here.)

Timeline for d1it9l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it9l2