Lineage for d1iray3 (1ira Y:205-311)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753943Protein Type-1 interleukin-1 receptor [49177] (1 species)
    duplication: tandem repeat of 3 domains
  7. 2753944Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries)
  8. 2753953Domain d1iray3: 1ira Y:205-311 [21719]
    Other proteins in same PDB: d1irax_
    complexed with nag

Details for d1iray3

PDB Entry: 1ira (more details), 2.7 Å

PDB Description: complex of the interleukin-1 receptor with the interleukin-1 receptor antagonist (il1ra)
PDB Compounds: (Y:) interleukin-1 receptor

SCOPe Domain Sequences for d1iray3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysvenp
ankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliypv

SCOPe Domain Coordinates for d1iray3:

Click to download the PDB-style file with coordinates for d1iray3.
(The format of our PDB-style files is described here.)

Timeline for d1iray3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1irax_