Lineage for d1ikfl2 (1ikf L:108-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028190Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2028422Species Mouse (Mus musculus) [TaxId:10090] [88567] (358 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2028587Domain d1ikfl2: 1ikf L:108-214 [21086]
    Other proteins in same PDB: d1ikfh1, d1ikfh2, d1ikfl1
    part of an anti-cyclosporin A Fab

Details for d1ikfl2

PDB Entry: 1ikf (more details), 2.5 Å

PDB Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
PDB Compounds: (L:) igg1-kappa r45-45-11 fab (light chain)

SCOPe Domain Sequences for d1ikfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikfl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnraac

SCOPe Domain Coordinates for d1ikfl2:

Click to download the PDB-style file with coordinates for d1ikfl2.
(The format of our PDB-style files is described here.)

Timeline for d1ikfl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ikfl1