Lineage for d1iisb3 (1iis B:232-339)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) 
Domain d1iisb3: 1iis B:232-339 [302511]
automated match to d1hzhh3
complexed with man
Details for d1iisb3
PDB Entry: 1iis (more details), 3 Å
PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)
PDB Compounds: (B:) Ig gamma-1 chain C regionSCOPe Domain Sequences for d1iisb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iisb3 b.1.1.2 (B:232-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvevhnaktkp
reeqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiska
SCOPe Domain Coordinates for d1iisb3:
Click to download the PDB-style file with coordinates for d1iisb3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iisb3:
- d1iisb3 is new in SCOPe 2.06-stable
- d1iisb3 appears in SCOPe 2.07
- d1iisb3 appears in the current release, SCOPe 2.08
View in 3D
