Lineage for d1igyb3 (1igy B:236-361)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293085Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1293145Species Mouse (Mus musculus) [TaxId:10090] [88586] (1 PDB entry)
  8. 1293146Domain d1igyb3: 1igy B:236-361 [20876]
    Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb2, d1igyb4, d1igyc1, d1igyc2, d1igyd1, d1igyd2, d1igyd4
    part of intact IgG1 antibody Mab61.1.3

Details for d1igyb3

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (B:) igg1 intact antibody mab61.1.3

SCOPe Domain Sequences for d1igyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus) [TaxId: 10090]}
gckpcictvpevssvfifppkpkdtllitvtpkvtcvvvdiskddpevqfswfvdnvevh
taqtqpreeqfnstfrvvsalpimhqdwlngkefkcrvnsaafpapiektisktkg

SCOPe Domain Coordinates for d1igyb3:

Click to download the PDB-style file with coordinates for d1igyb3.
(The format of our PDB-style files is described here.)

Timeline for d1igyb3: