Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
Domain d1igtb2: 1igt B:115-235 [20867] Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb3, d1igtb4, d1igtc1, d1igtc2, d1igtd1, d1igtd3, d1igtd4 |
PDB Entry: 1igt (more details), 2.8 Å
SCOP Domain Sequences for d1igtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtb2 b.1.1.2 (B:115-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik
Timeline for d1igtb2: