Lineage for d1igoa_ (1igo A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) Protein Xylanase II [49979] (18 species)
Partial overlap with common fold and the active sites of the other endoglucanases
Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry) 
Domain d1igoa_: 1igo A: [71209]
complexed with so4
Details for d1igoa_
PDB Entry: 1igo (more details), 2.2 Å
PDB Description: Family 11 xylanase
PDB Compounds: (A:) family 11 xylanaseSCOPe Domain Sequences for d1igoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igoa_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis, B230 [TaxId: 1423]}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl
SCOPe Domain Coordinates for d1igoa_:
Click to download the PDB-style file with coordinates for d1igoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1igoa_:
- d1igoa_ first appeared in SCOP 1.61
- d1igoa_ appears in SCOPe 2.03
- d1igoa_ appears in SCOPe 2.05
- d1igoa_ appears in the current release, SCOPe 2.08
View in 3D
