Lineage for d1igml_ (1igm L:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries) 
Domain d1igml_: 1igm L: [19826]
Other proteins in same PDB: d1igmh_
part of IgM Fv POT
Details for d1igml_
PDB Entry: 1igm (more details), 2.3 Å
PDB Description: three dimensional structure of an fv from a human igm immunoglobulin
PDB Compounds: (L:) igm-kappa pot fv (light chain)SCOPe Domain Sequences for d1igml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igml_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisnylawyqqkpgkapelriydasnletgvps
rfsgsgsgtdftftisslqpediatyycqqyqnlpltfgpgtkvdikrtvaapsv
SCOPe Domain Coordinates for d1igml_:
Click to download the PDB-style file with coordinates for d1igml_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1igml_:
- d1igml_ first appeared (with stable ids) in SCOP 1.55
- d1igml_ appears in SCOP 1.75
- d1igml_ appears in SCOPe 2.02
- d1igml_ appears in the current release, SCOPe 2.08
View in 3D
