Lineage for d1ieha_ (1ieh A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510256Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1510296Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)
  8. 1510304Domain d1ieha_: 1ieh A: [71199]
    VHh BRUC.D4.4

Details for d1ieha_

PDB Entry: 1ieh (more details)

PDB Description: solution structure of a soluble single-domain antibody with hydrophobic residues typical of a vl/vh interface
PDB Compounds: (A:) bruc.d4.4

SCOPe Domain Sequences for d1ieha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy
adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse
qkliseedlnhhhhh

SCOPe Domain Coordinates for d1ieha_:

Click to download the PDB-style file with coordinates for d1ieha_.
(The format of our PDB-style files is described here.)

Timeline for d1ieha_: