Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-4 receptor alpha chain [49287] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49288] (1 PDB entry) |
Domain d1iarb1: 1iar B:1-96 [22037] Other proteins in same PDB: d1iara_ |
PDB Entry: 1iar (more details), 2.3 Å
SCOPe Domain Sequences for d1iarb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iarb1 b.1.2.1 (B:1-96) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} fkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv chllmddvvsadnytldlwagqqllwkgsfkpsehv
Timeline for d1iarb1: