Lineage for d1iarb1 (1iar B:1-96)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Interleukin-4 receptor alpha chain [49287] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49288] (1 PDB entry) 
Domain d1iarb1: 1iar B:1-96 [22037]
Other proteins in same PDB: d1iara_
Details for d1iarb1
PDB Entry: 1iar (more details), 2.3 Å
PDB Description: interleukin-4 / receptor alpha chain complex
PDB Compounds: (B:) protein (interleukin-4 receptor alpha chain)SCOPe Domain Sequences for d1iarb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iarb1 b.1.2.1 (B:1-96) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
fkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv
chllmddvvsadnytldlwagqqllwkgsfkpsehv
SCOPe Domain Coordinates for d1iarb1:
Click to download the PDB-style file with coordinates for d1iarb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iarb1:
- d1iarb1 first appeared (with stable ids) in SCOP 1.55
- d1iarb1 appears in SCOPe 2.07
View in 3D
