Lineage for d1i94b_ (1i94 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466923Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2466924Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2466925Protein Ribosomal protein S2 [52315] (3 species)
  7. 2466962Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 2466974Domain d1i94b_: 1i94 B: [61991]
    Other proteins in same PDB: d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94b_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1i94b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
aeatetpeg

SCOPe Domain Coordinates for d1i94b_:

Click to download the PDB-style file with coordinates for d1i94b_.
(The format of our PDB-style files is described here.)

Timeline for d1i94b_: