Lineage for d1i4pa1 (1i4p A:1-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059123Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)
  7. 2059124Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries)
  8. 2059125Domain d1i4pa1: 1i4p A:1-120 [61723]
    Other proteins in same PDB: d1i4pa2
    complexed with zn

Details for d1i4pa1

PDB Entry: 1i4p (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
PDB Compounds: (A:) enterotoxin type c-2

SCOPe Domain Sequences for d1i4pa1:

Sequence, based on SEQRES records: (download)

>d1i4pa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d1i4pa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg

SCOPe Domain Coordinates for d1i4pa1:

Click to download the PDB-style file with coordinates for d1i4pa1.
(The format of our PDB-style files is described here.)

Timeline for d1i4pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4pa2