Lineage for d1i3za_ (1i3z A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918855Protein Ews/fli1 activated transcript 2, Eat2 [89999] (1 species)
  7. 1918856Species Mouse (Mus musculus) [TaxId:10090] [90000] (1 PDB entry)
  8. 1918857Domain d1i3za_: 1i3z A: [83667]
    complex with slam phosphopeptide, chain B

Details for d1i3za_

PDB Entry: 1i3z (more details), 2.15 Å

PDB Description: murine eat2 sh2 domain in complex with slam phosphopeptide
PDB Compounds: (A:) ews/fli1 activated transcript 2

SCOPe Domain Sequences for d1i3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]}
mdlpyyhgcltkrecealllkggvdgnflirdsesvpgalclcvsfkklvysyrifrekh
gyyrietdahtprtifpnlqelvskygkpgqglvvhlsnpimr

SCOPe Domain Coordinates for d1i3za_:

Click to download the PDB-style file with coordinates for d1i3za_.
(The format of our PDB-style files is described here.)

Timeline for d1i3za_: