Lineage for d1i3va_ (1i3v A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) 
Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries) 
Domain d1i3va_: 1i3v A: [61637]
dye RR1-binding VHh domain
Details for d1i3va_
PDB Entry: 1i3v (more details), 2.03 Å
PDB Description: three-dimensional structure of a lama vhh domain unliganded
PDB Compounds: (A:) antibody vhh lama domainSCOPe Domain Sequences for d1i3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3va_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtvss
SCOPe Domain Coordinates for d1i3va_:
Click to download the PDB-style file with coordinates for d1i3va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i3va_:
- d1i3va_ first appeared in SCOP 1.57
- d1i3va_ appears in SCOPe 2.03
- d1i3va_ appears in SCOPe 2.05
- d1i3va_ appears in the current release, SCOPe 2.08, called d1i3va1
View in 3D
