Class g: Small proteins [56992] (92 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
Domain d1i3qi2: 1i3q I:50-122 [61616] Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qj_, d1i3qk_, d1i3ql_ protein/RNA complex; complexed with mg, zn |
PDB Entry: 1i3q (more details), 3.1 Å
SCOPe Domain Sequences for d1i3qi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3qi2 g.41.3.1 (I:50-122) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtqfs
Timeline for d1i3qi2: