Lineage for d1hzoa_ (1hzo A:)
- Root: SCOPe 2.05
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) 
Protein beta-Lactamase, class A [56606] (16 species) 
Species Proteus vulgaris [TaxId:585] [75596] (1 PDB entry) 
Domain d1hzoa_: 1hzo A: [71092]
complexed with mes
Details for d1hzoa_
PDB Entry: 1hzo (more details), 1.75 Å
PDB Description: structure of class a cephalosporinase from proteus vulgaris k1
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d1hzoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzoa_ e.3.1.1 (A:) beta-Lactamase, class A {Proteus vulgaris [TaxId: 585]}
ntieeqlntlekysqgrlgvalintednsqityrgeerfamastskvmavaavlkasekq
aglldknitikksdlvayspitekhlttgmtlaelsaatlqysdntamnkildylggpak
vtqfarsindvtyrldrkepelntaihgdprdttspiamakslqaltlgdalgqsqrqql
vtwlkgnttgdnsikaglpkhwvvgdktgsgdygttndiaviwpenhaplilvvyftqqe
qnakyrkdiiakaaeivtkeisns
SCOPe Domain Coordinates for d1hzoa_:
Click to download the PDB-style file with coordinates for d1hzoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzoa_:
- d1hzoa_ first appeared in SCOP 1.61
- d1hzoa_ appears in SCOPe 2.04
- d1hzoa_ appears in SCOPe 2.06
- d1hzoa_ appears in the current release, SCOPe 2.08
View in 3D
